General Information

  • ID:  hor005543
  • Uniprot ID:  P06833
  • Protein name:  Caltrin
  • Gene name:  PYY2
  • Organism:  Bos taurus (Bovine)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0005516 calmodulin binding; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0042742 defense response to bacterium
  • GO CC:  GO:0005615 extracellular space

Sequence Information

  • Sequence:  SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK
  • Length:  48
  • Propeptide:  MMAGRRSWPAMATVLLALLVCLGELVDSKPQPSDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK
  • Signal peptide:  MMAGRRSWPAMATVLLALLVCLGELVDSKPQP
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits calcium transport into spermatozoa. Inhibits the growth of microorganisms. Seem to act as an antibiotic by permeabilizing the bacterial membrane.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06833-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005543_AF2.pdbhor005543_ESM.pdb

Physical Information

Mass: 637780 Formula: C245H395N77O70
Absent amino acids: CMQ Common amino acids: KLS
pI: 11.07 Basic residues: 13
Polar residues: 13 Hydrophobic residues: 15
Hydrophobicity: -99.38 Boman Index: -14414
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 71.25
Instability Index: 2486.04 Extinction Coefficient cystines: 6990
Absorbance 280nm: 148.72

Literature

  • PubMed ID:  3863108
  • Title:  The structure of caltrin, the calcium-transport inhibitor of bovine seminal plasma.
  • PubMed ID:  16453469
  • Title:  Amino acid sequence of seminalplasmin, an antimicrobial protein from bull semen.
  • PubMed ID:  2423370
  • Title:  Seminalplasmin and caltrin are the same protein.
  • PubMed ID:  2334517
  • Title:  Functional properties of peptides derived from seminalplasmin: binding to monospecific anti-seminalplasmin immunoglobulins G and calmodulin.